toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Büstenmacher (medium) by KI-Vossy tagged putin,afd,weidel,chrupalla,spiegel,keil,kreml,russland,umgang,macht,machtkampf,wahl,wahlen,regierung,reisen,partei,kritik,tino,putin,afd,weidel,chrupallsa,spiegel,keil,kreml,russland,umgang,macht,machtkampf,wahl,wahlen,regierung,reisen,partei,kritik

Büstenmacher

#473998 / viewed 717 times
KI-Vossy του/της KI-Vossy
on November 15, 2025
rating-star 3
Applause
favorite
Favorite
report spam
Spam

Spiegel-Online spekuliert, dass der russische Präsident Vladimir Putin einen Keil zwischen den AfD-Chefs Tino Chrupalla und Alice Elisabeth Weidel treibt. Die AfD streitet über den Umgang mit dem Kreml. Dahinter steht der Machtkampf zwischen den beiden Parteichefs und ihre Unterstützer bringen sich bereits in Stellung. In der AfD haben geplante Russland-Reisen von Parteimitgliedern für Diskussionen gesorgt.

Während von Parteichefin Weidel zuletzt deutliche Kritik kam, hat sich nun auch Co-Chef Chrupalla geäußert - und die Pläne verteidigt.

Dazu ein erklärender Blick in Putins Werkstatt …

Πολιτικά »  National/Domestic  International  Elections  Taxes  Finances  Economy & Money  Education  Historical  Other  Politicians  Parties  Democracy

putinafdweidelchrupallaspiegelkeilkremlrusslandumgangmachtmachtkampfwahlwahlenregierungreisenparteikritiktinoputinafdweidelchrupallsaspiegelkeilkremlrusslandumgangmachtmachtkampfwahlwahlenregierungreisenparteikritik

Collections

(1)
Political Cartoons - International!

Σχόλια (1)

 
Shahid Atiq
Member
Excellent!

Shahid Atiq, on November 16, 2025  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη KI-Vossy


Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
Cartoon: Elons Revenge (small) by KI-Vossy tagged elon,musk,tesla,potus,halloween,pumpkin,pumpkins,usa,america,american,republican,republicans,eve,dead,deads,celebrate,celebrations,celebration,sweet,sweets,kürbis,kürbisse
Elons Revenge
Cartoon: Der Kanzlerkleber (small) by KI-Vossy tagged migration,exil,kanzler,spd,scholz,pressekonferenz,sommerpause,urlaub,biden,bundeskanzler,bundestagswahl,wahlen,ki,deutschland,cumex
Der Kanzlerkleber
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.