toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Das schaffen wir! (medium) by SoRei tagged merkel,das,schaffen,wir,stammtisch,kneipe,stammtischpolitik,alkohol,rechtsstaatlichkeit,wohlstand,geister,flüchtlingswelle,flüchtlingskrise,asyldiskussion,asylrecht,bleiberecht,flucht,flüchtlingsschwemme,optimismus,riss,in,der,gesellschaft,integration,asylpolitik,merkel,das,schaffen,wir,stammtisch,kneipe,stammtischpolitik,alkohol,rechtsstaatlichkeit,wohlstand,geister,flüchtlingswelle,flüchtlingskrise,asyldiskussion,asylrecht,bleiberecht,flucht,flüchtlingsschwemme

Das schaffen wir!

#257062 / viewed 5572 times
SoRei του/της SoRei
on October 15, 2015
rating-star 1
Applause
favorite
Favorite
report spam
Spam

Stammtischpolitik nervt mehr denn je.

Πολιτικά »  National/Domestic  International  Finances  Economy & Money  Immigration  Other  Conflicts & War  Politicians  Democracy

merkeldasschaffenwirstammtischkneipestammtischpolitikalkoholrechtsstaatlichkeitwohlstandgeisterflüchtlingswelleflüchtlingskriseasyldiskussionasylrechtbleiberechtfluchtflüchtlingsschwemmeoptimismusrissindergesellschaftintegrationasylpolitikmerkeldasschaffenwirstammtischkneipestammtischpolitikalkoholrechtsstaatlichkeitwohlstandgeisterflüchtlingswelleflüchtlingskriseasyldiskussionasylrechtbleiberechtfluchtflüchtlingsschwemme

Σχόλια (3)

 
Jenaerin
Member
Beides!

Jenaerin, on September 27, 2019  report post  απάντηση applause 0

 
SoRei
Member
Doch. Ich schon!

SoRei, on October 19, 2015  report post  απάντηση applause 0

 
JotKa
Member
:-))

JotKa, on October 19, 2015  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη SoRei


Cartoon: Frühling (small) by SoRei tagged virus,corona,mutation,mutant,hülle,keime,gene,ändern,viren,erbgut,dns,rns,zellen,infizieren,wirtszelle,proteine,erreger,nachkommen,reproduktionszyklus,immunsystem,erkennen,gendrift,genshift,enzyme,polymerasen,vervielfältigen,vermehren,kopieren,varianten,neu,kreation,flirt,anbaggern,anmachen,unmoralisches,angebot,sex,dating,special,interest,anzüglich,verführen,betören,eiweis,peptide,forschung,biologie,medizien,mikrokosmos,kommunikation,nachwuchs,gesundheit,symbiose,pandemie
Frühling
Cartoon: Ladies  Gentlemen! (small) by SoRei tagged wartezimmer,benehmen,etikette,anstand,grüßen,grußlos,fremde,menschen,leuteunerwidert,unfreundlich,unhöflich,respektlos,kinderstube,reaktion
Ladies Gentlemen!
Cartoon: Daddy Cool (small) by SoRei tagged vater,tochter,freund,meinung,meinungsmache,pubertät,partnerwahl,partnerschaft,erste,liebe,vorstellen,vorurteil,erwartung,wunschdenken,missverständnis,entschuldigung,vorwurf,beleidigung,beleidigt,potenz,potent,impotenz,impotent,potentiell,versager,versorger,potential,verhören,verstehen,missverstehen,erwartungshaltung
Daddy Cool
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.