toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Gipfelstürmer (medium) by RABE tagged merkel,bundeskanzlerin,reden,regierungserklärungen,eu,gipfel,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,kanzlerkandidat,olaf,scholz,spd,gipfeltreffen,matrosenanzug,bergsteiger,rom,un,glasgow,klimagipfel,wirtschaftsstaaten,klimaabkommen,amtseinführung,merkel,bundeskanzlerin,reden,regierungserklärungen,eu,gipfel,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,kanzlerkandidat,olaf,scholz,spd,gipfeltreffen,matrosenanzug,bergsteiger,rom,un,glasgow,klimagipfel,wirtschaftsstaaten,klimaabkommen,amtseinführung

Gipfelstürmer

#393923 / viewed 3280 times
RABE του/της RABE
on October 31, 2021
rating-star 5
Applause
favorite
Favorite
report spam
Spam

Ohne Worte

Πολιτικά »  National/Domestic  International  Elections  Military & Security  Taxes  Third World  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

merkelbundeskanzlerinredenregierungserklärungeneugipfelraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonkanzlerkandidatolafscholzspdgipfeltreffenmatrosenanzugbergsteigerromunglasgowklimagipfelwirtschaftsstaatenklimaabkommenamtseinführungmerkelbundeskanzlerinredenregierungserklärungeneugipfelraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonkanzlerkandidatolafscholzspdgipfeltreffenmatrosenanzugbergsteigerromunglasgowklimagipfelwirtschaftsstaatenklimaabkommenamtseinführung

Σχόλια (3)

 
Harm Bengen
Member
dem jungen bleibt auch nichts erspart.

Harm Bengen, on October 31, 2021  report post  απάντηση applause 0

 
Erl
Member
Mother Merkel’s Son

Erl, on October 31, 2021  report post  απάντηση applause 0

 
marian kamensky
Member
Schwerer Los!

marian kamensky, on October 31, 2021  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη RABE


Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
Cartoon: Vulkanologen (small) by RABE tagged israel,palästina,palästinenser,iran,flächenbrand,drohnenangriff,eskalation,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,feuerlöscher,feuerwehr,hydrant,flammen,öl,oel,vulkan,kugel,lava,vulkankegel,krater
Vulkanologen
Cartoon: Neues aus Schlumpfhausen (small) by RABE tagged corona,bundländerkonferenz,merkel,kanzleramt,lockerungen,stufenplan,öffnungen,lockdown,shutdown,baumärkte,impfdosen,rki,fallzahlen,inzidenzwert,söder,olaf,scholz,scholzomat,schlüpfe,schlumpf,oberschlumpf,schlumpfhausen,beschimpfung,schlaubi
Neues aus Schlumpfhausen
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.