toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Grüne FDP-Verkehrspolitik... (medium) by markus-grolik tagged verkehrswende,auto,elektromobililtaet,autofahrer,suv,lobby,diesel,verkehrspolitik,wissing,fdp,city,innenstadt,stau,luftverschmutzung,benzin,verbrenner,eauto,stadt,erlaubnis,verkehrswende,auto,elektromobililtaet,autofahrer,suv,lobby,diesel,verkehrspolitik,wissing,fdp,city,innenstadt,stau,luftverschmutzung,benzin,verbrenner,eauto,stadt,erlaubnis

Grüne FDP-Verkehrspolitik...

#436489 / viewed 2571 times
markus-grolik του/της markus-grolik
on January 03, 2024
rating-star 6
Applause
favorite
Favorite
report spam
Spam

...

Επιχειρηματικά »  Trade & Sale  Economic Cycle  Automotive

verkehrswendeautoelektromobililtaetautofahrersuvlobbydieselverkehrspolitikwissingfdpcityinnenstadtstauluftverschmutzungbenzinverbrennereautostadterlaubnisverkehrswendeautoelektromobililtaetautofahrersuvlobbydieselverkehrspolitikwissingfdpcityinnenstadtstauluftverschmutzungbenzinverbrennereautostadterlaubnis

Σχόλια (3)

 
Harm Bengen
Member
geht doch.

Harm Bengen, on January 03, 2024  report post  απάντηση applause 0

 
RABE
Member
Bären aufgebunden*****

RABE, on January 03, 2024  report post  απάντηση applause 0

 
Erl
Member
Er kann sich´s leisten.

Erl, on January 03, 2024  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη markus-grolik


Cartoon: Preissteigerung ... (small) by markus-grolik tagged pries,lebenmittelpreise,inflationsrate,inflation,preissteigerung,lebensmittel,aldidiscounter,gas,erdgas,energie,rentner,niedriglohn,dünger,landwirtschaft,deutschland,russland
Preissteigerung ...
Cartoon: Wacken 2023 (small) by markus-grolik tagged wacken,hardrock,openair,festival,sanitaer,metal,heavy,laermpegel,fans,schlamm,regen
Wacken 2023
Cartoon: Mangelverwaltung (small) by markus-grolik tagged priorisierung,pcr,test,mangel,corona,antigen,schnelltest,lauterbach,expertenrat,gesundheitsminister,regeln,massnahmen,omikron,chaos,deutschland
Mangelverwaltung
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.