toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Impfanbieter... (medium) by markus-grolik tagged spahn,rki,merkel,impfkampagne,impfangebot,impfpflicht,impfverweigerer,werbung,deutschland,bundesregierung,pandemie,corona,delta,herdenimmunitaet,spahn,rki,merkel,impfkampagne,impfangebot,impfpflicht,impfverweigerer,werbung,deutschland,bundesregierung,pandemie,corona,delta,herdenimmunitaet

Impfanbieter...

#387333 / viewed 2488 times
markus-grolik του/της markus-grolik
on July 13, 2021
rating-star 6
Applause
favorite
Favorite
report spam
Spam

...

Πολιτικά »  National/Domestic  Elections  Taxes  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Fraud & Corruption  Other  Politicians  Parties  Privacy & Customer  Democracy

spahnrkimerkelimpfkampagneimpfangebotimpfpflichtimpfverweigererwerbungdeutschlandbundesregierungpandemiecoronadeltaherdenimmunitaetspahnrkimerkelimpfkampagneimpfangebotimpfpflichtimpfverweigererwerbungdeutschlandbundesregierungpandemiecoronadeltaherdenimmunitaet

Σχόλια (5)

 
Barthold
Member
bin ich denn schon so besoffen, dass ich sechsfach sehe??

Barthold, on July 13, 2021  report post  απάντηση applause 0

 
Harm Bengen
Member
herr doktor, ich höre stimmen.

Harm Bengen, on July 13, 2021  report post  απάντηση applause 0

 
RABE
Member
Spahn geklont!*****

RABE, on July 13, 2021  report post  απάντηση applause 0

 
zenundsenf
Member
verkauf auch noch was anderes, jens!!!

zenundsenf, on July 13, 2021  report post  απάντηση applause 0

 
Paolo Calleri
Member
jens stalk

Paolo Calleri, on July 13, 2021  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη markus-grolik


Cartoon: Dealmakerdance... (small) by markus-grolik tagged dealmaker,trumpiran,hormus,casting,show,mullahs,deal,dealmaking,usa,us
Dealmakerdance...
Cartoon: Mangelverwaltung (small) by markus-grolik tagged priorisierung,pcr,test,mangel,corona,antigen,schnelltest,lauterbach,expertenrat,gesundheitsminister,regeln,massnahmen,omikron,chaos,deutschland
Mangelverwaltung
Cartoon: Lauterbachs Klinik-Atlas... (small) by markus-grolik tagged klinikatlas,klinik,fachklinik,krankenhaus,gesundheitsminister,lauterbach,deutschland,gesundheitssystem,stadt,land,krankenkassen,klinikreform,fallpauschalen
Lauterbachs Klinik-Atlas...
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.