toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Impftal (medium) by leopold maurer tagged impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel,impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel

Impftal

#376600 / viewed 2308 times
leopold maurer του/της leopold maurer
on February 01, 2021
rating-star 5
Applause
favorite
Favorite
report spam
Spam

...

Πολιτικά »  National/Domestic  International  Health

impfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangelimpfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangel

Σχόλια (7)

Σχολιάστε  
markus-grolik
Member
Alternativlos...

markus-grolik, on February 02, 2021  report post  απάντηση applause 0

 
Guest Avatar
Deleted
...für all die Zombies da draußen, die geimpft werden wollen!

, on February 01, 2021  report post  απάντηση applause 0

 
zenundsenf
Member
die schaffen das!

zenundsenf, on February 01, 2021  report post  απάντηση applause 0

 
Erl
Member
:-)))))

Erl, on February 01, 2021  report post  απάντηση applause 0

 
RABE
Member
An Worten nie verlegen!*****

RABE, on February 01, 2021  report post  απάντηση applause 0

 
Harm Bengen
Member
"weniger ist mehr".

Harm Bengen, on February 01, 2021  report post  απάντηση applause 0

 
Barthold
Member
ein Gesicht das nach akuter Suizidgefahr aussieht

Barthold, on February 01, 2021  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη leopold maurer


Cartoon: 2G in Österreich (small) by leopold maurer tagged österreich,inzidenz,corona,covid,genesen,geimpft,test,pcr,antigen,frisör,gasthaus,theater,impfung,impfgegner,impfverweigerer,hospitalisiert,intensivstation,jodeln
2G in Österreich
Cartoon: Baerbock und Lawrow (small) by leopold maurer tagged baerbock,lawrow,aussenministerin,deutschland,russland,ukraine,konflikt,nato,menschenrechte,gas,nordstream,diplomatie,lösung,verhandlung,antrittsbesuch,sanktionen,krieg,leopold,maurer,cartoon,karikatur
Baerbock und Lawrow
Cartoon: trumps nobelpreistraum (small) by leopold maurer tagged nobelpreis,trump,donald,steuer,wirtschaft,wahl
trumps nobelpreistraum
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.