toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Lack of Intelligence (medium) by KI-Vossy tagged usa,trump,intelligece,health,vaccine,marks,fda,drugs,disinformation,lies,kennedy,resistance,media,pressure,immune,potus,usa,trump,intelligece,health,vaccine,marks,fda,drugs,disinformation,lies,kennedy,resistance,media,pressure

Lack of Intelligence

#461197 / viewed 1771 times
KI-Vossy του/της KI-Vossy
on March 29, 2025
rating-star 3
Applause
favorite
Favorite
report spam
Spam

The U.S. government's top vaccine expert, Peter Marks, has resigned as head of the FDA's vaccine division, which oversees drug and food safety.

The New York Times and the Washington Post both reported the news. Marks described his move as a protest against "disinformation and lies" following the appointment of U.S. Secretary of Health and Human Services Robert F. Kennedy Jr.

In his resignation letter, he complained of "unprecedented attacks on scientific truth" by the secretary and his supporters.

According to US media reports, Marks may also have been pressured into resigning.

He probably had too little resistance

Πολιτικά »  National/Domestic  Finances  Economy & Money  Health  Family & Youth  Education  Confederations  Jobs & Social  Historical  Other  Politicians  Parties  Privacy & Customer  Democracy

usatrumpintelligecehealthvaccinemarksfdadrugsdisinformationlieskennedyresistancemediapressureimmunepotususatrumpintelligecehealthvaccinemarksfdadrugsdisinformationlieskennedyresistancemediapressure

Collections

(3)
Political Cartoons - International!
PRESIDENT DONALD TRUMP
U.S.A

Σχόλια (1)

 
Enrico Bertuccioli
Member
Good one.

Enrico Bertuccioli, on March 31, 2025  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη KI-Vossy


Cartoon: Wo ist mein Paket? (small) by KI-Vossy tagged bundesnetzagentur,pakete,post,briefe,paketdienstleister,dpd,dhl,hermes,ups,reklamationen,beschwerden,gls,deutschland,berlin,späti,paketdienst
Wo ist mein Paket?
Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: Change of mind (small) by KI-Vossy tagged trump,usa,potus,venezuela,mexico,mexiko,war,iran,peace,price,maduro,destruction,worldwar,ww3,cuba,greenland,kuba,grönland,kolumbien,colombia,threat,us,president,krieg,weltordnung,world,order
Change of mind
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.