toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Nato Fettnapf (medium) by RABE tagged nato,natogipfel,gipfeltreffen,brüssel,stoltenberg,trump,president,militärausgaben,steigerung,wehretat,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,butler,diener,badewanne,napf,fettnapf,fett,merkel,russland,geisel,enrgieversorgung,gazprom,nato,natogipfel,gipfeltreffen,brüssel,stoltenberg,trump,president,militärausgaben,steigerung,wehretat,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,butler,diener,badewanne,napf,fettnapf,fett,merkel,russland,geisel,enrgieversorgung,gazprom

Nato Fettnapf

#317634 / viewed 4030 times
RABE του/της RABE
on July 11, 2018
rating-star 7
Applause
favorite
Favorite
report spam
Spam

Ohne Worte

Πολιτικά »  National/Domestic  International  Elections  Military & Security  Taxes  Third World  Terrorism  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

natonatogipfelgipfeltreffenbrüsselstoltenbergtrumppresidentmilitärausgabensteigerungwehretatraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonbutlerdienerbadewannenapffettnapffettmerkelrusslandgeiselenrgieversorgunggazpromnatonatogipfelgipfeltreffenbrüsselstoltenbergtrumppresidentmilitärausgabensteigerungwehretatraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonbutlerdienerbadewannenapffettnapffettmerkelrusslandgeiselenrgieversorgunggazprom

Σχόλια (5)

 
Andreas Prüstel
Member
fett mit brett.

Andreas Prüstel, on July 12, 2018  report post  απάντηση applause 0

 
Erl
Member
Fett in fett, das wird nett.

Erl, on July 11, 2018  report post  απάντηση applause 0

 
Harm Bengen
Member
ist er eigentlich als fussbad gewöhnt.

Harm Bengen, on July 11, 2018  report post  απάντηση applause 0

 
marian kamensky
Member
Wie am Butteschnürchen!

marian kamensky, on July 11, 2018  report post  απάντηση applause 0

 
JotKa
Member
Aber schön fettiges Fett nehmen.*****

JotKa, on July 11, 2018  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη RABE


Cartoon: Der Aufschwung kommt (small) by RABE tagged optimismus,euro,aufschwung,bilanz,wirtschaftsminister,firma,büro,schreibtisch,computer,papierkorb,reck,sportgerät,abreißkalender,konjunktur,mitarbeiter,abgestellte
Der Aufschwung kommt
Cartoon: Scheuerhorse (small) by RABE tagged scheuer,verkehrsminister,csu,fdp,wissing,maut,cartoon,karikatur,pressezeichnung,farbcarton,tagescartoon,regress,schaden,schadenersatz,schadenersatzforderung,verfolgung,bestrafung,millionen,steuerzahler
Scheuerhorse
Cartoon: Retortenburger (small) by RABE tagged burger,retortenburger,gewebe,gewebezüchterei,metzgerei,metzger,fleischer,fleischerei,fleisch,enzyme,labor,wissenschaftler,reagenzglas,stammzellen,rinderstammzellen,fleischklops,niederlande,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,wurs
Retortenburger
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.