toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Nobelpreisverdächtig (medium) by RABE tagged nobel,nobelpreis,nobelpreisverleihung,stockholm,wirtschaft,chemie,physik,literatur,friedensnobelpreis,bahn,bundesbahn,verspätung,zugausfall,bahnsteig,reisende,kunden,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,gleis,servicepoint,medizin,fahrpreis,ticket,fahrpreiserhöhung,bahncard,preissteigerung,dezember,nobel,nobelpreis,nobelpreisverleihung,stockholm,wirtschaft,chemie,physik,literatur,friedensnobelpreis,bahn,bundesbahn,verspätung,zugausfall,bahnsteig,reisende,kunden,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,gleis,servicepoint,medizin,fahrpreis,ticket,fahrpreiserhöhung,bahncard,preissteigerung,dezember

Nobelpreisverdächtig

#209590 / viewed 6220 times
RABE του/της RABE
on October 07, 2013
rating-star 10
Applause
favorite
Favorite
report spam
Spam

Ohne Worte

Πολιτικά »  National/Domestic  Elections  Taxes  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Fraud & Corruption  Other  Politicians  Parties  Democracy

nobelnobelpreisnobelpreisverleihungstockholmwirtschaftchemiephysikliteraturfriedensnobelpreisbahnbundesbahnverspätungzugausfallbahnsteigreisendekundenraberalfböhmecartoonkarikaturpressezeichnungfarbcartoongleisservicepointmedizinfahrpreisticketfahrpreiserhöhungbahncardpreissteigerungdezembernobelnobelpreisnobelpreisverleihungstockholmwirtschaftchemiephysikliteraturfriedensnobelpreisbahnbundesbahnverspätungzugausfallbahnsteigreisendekundenraberalfböhmecartoonkarikaturpressezeichnungfarbcartoongleisservicepointmedizinfahrpreisticketfahrpreiserhöhungbahncardpreissteigerungdezember

Σχόλια (11)

Σχολιάστε Σελίδα  1 2
manfredw
Member
Die Fahrpreise werden jetzt aber gesenkt, damit es sich nicht mehr lohnt, die Automaten zu sprengen.

manfredw, on October 11, 2013  report post  απάντηση applause 0

 
Marcus Gottfried
Member
Ja dann.... Gratulation.

Marcus Gottfried, on October 08, 2013  report post  απάντηση applause 0

 
Guest Avatar
Deleted
Zugverlässig allemal!

, on October 08, 2013  report post  απάντηση applause 0

 
edda von sinnen
Member
das ist ein echt guter Witz! *****:)

edda von sinnen, on October 07, 2013  report post  απάντηση applause 0

 
gore-g
Member
den ham se ja auch verdient

gore-g, on October 07, 2013  report post  απάντηση applause 0

 
JotKa
Member
Da sind sie absolut zuverlässig.

JotKa, on October 07, 2013  report post  απάντηση applause 0

 
Guest Avatar
Deleted
auf den Punkt gebracht.

, on October 07, 2013  report post  απάντηση applause 0

 
Andreas Prüstel
Member
sogar im sommer!

Andreas Prüstel, on October 07, 2013  report post  απάντηση applause 0

 
Erl
Member
... und auch bei jedem Wetter!*****

Erl, on October 07, 2013  report post  απάντηση applause 0

 
marian kamensky
Member
endlich sinnvoll gepriesen!

marian kamensky, on October 07, 2013  report post  απάντηση applause 0

 
Σελίδα  1 2

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη RABE


Cartoon: Kloserettung (small) by RABE tagged klose,deutschland,nationalelf,wm,brasilien,ghana,tor,unentschieden,löw,bundestrainer,torschütze,vorrunde,torschützenkönig,lef,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,pleite,euro,krise,fünfzehnte,rettung,geld,lohn,gehalt,blank,konto,k
Kloserettung
Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
Cartoon: Verstopfungserscheinung (small) by RABE tagged trump,usa,expräsident,florida,hausdurchsuchung,anwesen,fbi,dokumente,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,pömpel,verstopfung,toilette,toilettenschüssel,geheimdokumente,bundespolizei,razzia,donald
Verstopfungserscheinung
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.