toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Safety at work (medium) by Enrico Bertuccioli tagged workplace,work,death,safety,workplacesafety,fatalities,accident,accidentatwork,employment,precariousness,political,politicalcartoon,editorialcartoon,workplace,work,death,safety,workplacesafety,fatalities,accident,accidentatwork,employment,precariousness,political,politicalcartoon,editorialcartoon

Safety at work

#443460 / viewed 1892 times
Enrico Bertuccioli του/της Enrico Bertuccioli
on May 07, 2024
rating-star 2
Applause
favorite
Favorite
report spam
Spam

Five more deaths at work in Italy: https://www.ansa.it/amp/english/news/2024/05/06/five-workers-die-in-pal…

Πολιτικά »  National/Domestic  International  Elections  Finances  Pension  Economy & Money  Health  Family & Youth  Education  Confederations  Jobs & Social  Historical  Other  Politicians  Parties  Energy

workplaceworkdeathsafetyworkplacesafetyfatalitiesaccidentaccidentatworkemploymentprecariousnesspoliticalpoliticalcartooneditorialcartoonworkplaceworkdeathsafetyworkplacesafetyfatalitiesaccidentaccidentatworkemploymentprecariousnesspoliticalpoliticalcartooneditorialcartoon

Collections

(1)
Political Cartoons - International!

Σχόλια (6)

Σχολιάστε  
Enrico Bertuccioli
Member
Erl wrote:
A band-aid won't be enough.

Yes Erl.

Enrico Bertuccioli, on May 08, 2024  report post  απάντηση applause 0

 
Erl
Member
A band-aid won't be enough.

Erl, on May 08, 2024  report post  απάντηση applause 0

 
Enrico Bertuccioli
Member
Sven1978 wrote:
That give a little Bit of Hope.

Yes Sven...

Enrico Bertuccioli, on May 07, 2024  report post  απάντηση applause 0

 
Guest Avatar
Deleted
That give a little Bit of Hope.

, on May 07, 2024  report post  απάντηση applause 0

 
Enrico Bertuccioli
Member
Shahid Atiq wrote:
Great*****!

Thanks a lot Shahid.

Enrico Bertuccioli, on May 07, 2024  report post  απάντηση applause 0

 
Shahid Atiq
Member
Great*****!

Shahid Atiq, on May 07, 2024  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη Enrico Bertuccioli


Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Global warming (small) by Enrico Bertuccioli tagged globalwarming,environment,crisis,world,planetearth,earth,humanbeings,animals,oceans,life,death,warning,threat,devastation
Global warming
Cartoon: Trump vs justice (small) by Enrico Bertuccioli tagged trump,donaldtrump,elections,2024uselections,uspresidency,presidentialrace,indictment,trumpindictment,power,control,witchhunt,conspiracy,republicans,republicanparty,gop,democracy,authoritarianism,justice,presidentialelection,2024presidentialelection,political,usgovernment,politicalcartoon,editorialcartoon
Trump vs justice
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.