toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Toilet (medium) by Enrico Bertuccioli tagged meta,markzuckerberg,elonmusk,socialmedia,censorship,freespeech,fakenews,internet,money,business,monopoly,capitalism,neocapitalism,digitaldevices,data,bigdata,ai,technology,opportunism,leadership,trump,donaldtrump,control,artificialintelligence,aicontrol,power,political,politicalcartoon,editorialcartoon,meta,markzuckerberg,elonmusk,socialmedia,censorship,freespeech,fakenews,internet,money,business,monopoly,capitalism,neocapitalism,digitaldevices,data,bigdata,ai,technology,opportunism,leadership,trump,donaldtrump,control,artificialintelligence,aicontrol,power,political,politicalcartoon,editorialcartoon

Toilet

#456133 / viewed 1411 times
Enrico Bertuccioli του/της Enrico Bertuccioli
on January 09, 2025
rating-star 6
Applause
favorite
Favorite
report spam
Spam

No fact checkers allowed...

Πολιτικά »  National/Domestic  International  Elections  Military & Security  Terrorism  Finances  Economy & Money  Technology  Family & Youth  Education  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

metamarkzuckerbergelonmusksocialmediacensorshipfreespeechfakenewsinternetmoneybusinessmonopolycapitalismneocapitalismdigitaldevicesdatabigdataaitechnologyopportunismleadershiptrumpdonaldtrumpcontrolartificialintelligenceaicontrolpowerpoliticalpoliticalcartooneditorialcartoonmetamarkzuckerbergelonmusksocialmediacensorshipfreespeechfakenewsinternetmoneybusinessmonopolycapitalismneocapitalismdigitaldevicesdatabigdataaitechnologyopportunismleadershiptrumpdonaldtrumpcontrolartificialintelligenceaicontrolpowerpoliticalpoliticalcartooneditorialcartoon

Collections

(1)
Political Cartoons - International!

Σχόλια (8)

Σχολιάστε  
Enrico Bertuccioli
Member
MorituruS wrote:
The Age of Enlightenment was much more advanced than the post-factual age...*****

Sure MorituruS.

Enrico Bertuccioli, on January 09, 2025  report post  απάντηση applause 0

 
Enrico Bertuccioli
Member
Harm Bengen wrote:
very good!

Many thanks Harm.

Enrico Bertuccioli, on January 09, 2025  report post  απάντηση applause 0

 
Enrico Bertuccioli
Member
Erl wrote:
For big shitstorms!

Yes Erl.

Enrico Bertuccioli, on January 09, 2025  report post  απάντηση applause 0

 
Enrico Bertuccioli
Member
leopold maurer wrote:
super!*****!

Thanks a lot Leopold.

Enrico Bertuccioli, on January 09, 2025  report post  απάντηση applause 0

 
MorituruS
Member
The Age of Enlightenment was much more advanced than the post-factual age...*****

MorituruS, on January 09, 2025  report post  απάντηση applause 0

 
Harm Bengen
Member
very good!

Harm Bengen, on January 09, 2025  report post  απάντηση applause 0

 
Erl
Member
For big shitstorms!

Erl, on January 09, 2025  report post  απάντηση applause 0

 
leopold maurer
Member
super!*****!

leopold maurer, on January 09, 2025  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη Enrico Bertuccioli


Cartoon: Pope Francis 1936-2025 (small) by Enrico Bertuccioli tagged popefrancis,pope,religion,peace,tolerance,inheritance,death,popefrancisdeath,fraternity,political,politicalcartoon,editorialcartoon
Pope Francis 1936-2025
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Out of the tunnel (small) by Enrico Bertuccioli tagged future,crisis,global,political,war,environment,financial,food,exit,tunnel,world,planet,pandemic,industry,national,international,people,society,humanity,humanbeings
Out of the tunnel
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.