toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: qualifizierte Zuwanderung (medium) by Marcus Gottfried tagged schleuser,schiff,osteuropa,afrika,migranten,asylrecht,asyl,zuwanderung,italien,lampedusa,arbeitsmarkt,geeignet,ungeeignet,ertrinken,menschen,marcus,gottfried,cartoons,karikatur,zuwanderung,asyl,asylrecht,migranten,afrika,osteuropa,schiff,schleuser,italien,lampedusa,arbeitsmarkt,geeignet,ungeeignet,ertrinken,menschen,marcus,gottfried,cartoons,karikatur

qualifizierte Zuwanderung

#237832 / viewed 3523 times
Marcus Gottfried του/της Marcus Gottfried
on January 04, 2015
rating-star 3
Applause
favorite
Favorite
report spam
Spam

.

Πολιτικά

schleuserschiffosteuropaafrikamigrantenasylrechtasylzuwanderungitalienlampedusaarbeitsmarktgeeignetungeeignetertrinkenmenschenmarcusgottfriedcartoonskarikaturzuwanderungasylasylrechtmigrantenafrikaosteuropaschiffschleuseritalienlampedusaarbeitsmarktgeeignetungeeignetertrinkenmenschenmarcusgottfriedcartoonskarikatur

Σχόλια (2)

 
Andreas Prüstel
Member
genau!

Andreas Prüstel, on January 04, 2015  report post  απάντηση applause 0

 
Harm Bengen
Member
tja, die auslese...

Harm Bengen, on January 04, 2015  report post  απάντηση applause 0

 
 

Σχολιάστε
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη Marcus Gottfried


Cartoon: Muhammad Ali (small) by Marcus Gottfried tagged muhammad,ali,boxer,rumble,jungle,tod,sterben,boxkampf,cassius,clay,spielplatz,kinder,wissen,alter,zuordnung,al,qaida,is,isis,terror,information,freude,marcus,gottfried,cartoon,karikatur
Muhammad Ali
Cartoon: 20210427-TestenLassen (small) by Marcus Gottfried tagged corona,covid,test,infektion,pcr,antigen,baumarkt,lockdown,click,an,meet
20210427-TestenLassen
Cartoon: Meeresspiegel (small) by Marcus Gottfried tagged klima,klimaerwärmung,hochwasser,forschung,wetter,umwelt,umweltzerstörung,ozon,ozonloch,marcus,gottfried,cartoon,karikatur,wasser,flut,netz,telefon,handy,kommunikation,daten,klimaprognose,wasserstand,meer,meeresspiegel,überflutung,deich
Meeresspiegel
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.