toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Eilige Weihnacht (medium) by Mirco Tomicek tagged moderna,antrag,zulassung,corona,impfstoff,impfung,impfen,eu,europa,amerika,beantragen,zulassungsantrag,anträge,medizin,forschung,antivirus,viren,virus,bekämpfung,pandemie,lockdown,shutdown,spritze,weihnachten,weihnachtszeit,ferien,weihnachtsgeschenk,geschenk,eilig,schnell,eil,eile,verpackung,karikatur,pressekarikatur,cartoon,mirco,tomicek,moderna,antrag,zulassung,corona,impfstoff,impfung,impfen,eu,europa,amerika,beantragen,zulassungsantrag,anträge,medizin,forschung,antivirus,viren,virus,bekämpfung,pandemie,lockdown,shutdown,spritze,weihnachten,weihnachtszeit,ferien,weihnachtsgeschenk,geschenk,eilig,schnell,eil,eile,verpackung,karikatur,pressekarikatur,cartoon,mirco,tomicek

Eilige Weihnacht

#372166 / viewed 3683 times
Mirco Tomicek του/της Mirco Tomicek
on November 30, 2020
rating-star 2
Applause
favorite
Favorite
report spam
Spam

Moderna will Zulassung für Corona-Impfstoff in EU beantragen.

Εκπαίδευση & Τεχνολογία »  Science  Technology  Research  School  University  Learning & Education  Factories  Medical Engineering  Genetics

modernaantragzulassungcoronaimpfstoffimpfungimpfeneueuropaamerikabeantragenzulassungsantraganträgemedizinforschungantivirusvirenvirusbekämpfungpandemielockdownshutdownspritzeweihnachtenweihnachtszeitferienweihnachtsgeschenkgeschenkeiligschnelleileileverpackungkarikaturpressekarikaturcartoonmircotomicekmodernaantragzulassungcoronaimpfstoffimpfungimpfeneueuropaamerikabeantragenzulassungsantraganträgemedizinforschungantivirusvirenvirusbekämpfungpandemielockdownshutdownspritzeweihnachtenweihnachtszeitferienweihnachtsgeschenkgeschenkeiligschnelleileileverpackungkarikaturpressekarikaturcartoonmircotomicek

Σχόλια (0)

Σχολιάστε  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη Mirco Tomicek


Cartoon: Perspektiven (small) by Mirco Tomicek tagged wirtschaft,wirtschaftsgipfel,gipfel,peter,altmaier,unternehmen,hoffnung,lockerung,lockerungen,lockdown,shutdown,corona,covid19,hilfe,hilfen,coronahilfen,geld,zahlung,chance,öffnung,öffnungen,einzelhandel,zweite,dritte,welle,bundeswirtschaftsminister,krise,pandemie,cartoon,karikatur,pressekarikatur,mirco,tomicek
Perspektiven
Cartoon: Fit For Ostern (small) by Mirco Tomicek tagged ostern,ostereiersuche,eiersuche,eier,ostereier,suche,osterhase,hase,eiweißpulver,eiweiß,protein,fit,fitness,sport,gym,kraftsport,training,whey,proteine,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fit For Ostern
Cartoon: Wahl-Hörner (small) by Mirco Tomicek tagged landtagswahlen,landtags,landtag,wahlen,wahl,gewählt,briefwahl,hochrechnungen,hochrechnung,rheinland,pfalz,baden,württemberg,grüne,spd,cdu,armin,laschet,klatsche,malu,dreyer,winfried,kretschmann,koalition,ampel,rot,grün,gelb,sieger,politik,maskenaffäre,masken,corona,wahllokal,cartoon,karikatur,pressekarikatur,mirco,tomicek
Wahl-Hörner
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.