toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: The pandemic system (medium) by Enrico Bertuccioli tagged pandemic,cornavirus,covid19,virus,viral,economy,money,business,speculaiton,speculators,experiment,social,socialmedia,people,society,strategy,political,policy,politicians,inetrnational,global,national,crisis,data,bigdata,dataprotection,fakenews,news,fake,system,finance,financial,problem,government,pandemic,cornavirus,covid19,virus,viral,economy,money,business,speculaiton,speculators,experiment,social,socialmedia,people,society,strategy,political,policy,politicians,inetrnational,global,national,crisis,data,bigdata,dataprotection,fakenews,news,fake,system,finance,financial,problem,government

The pandemic system

#388974 / viewed 4889 times
Enrico Bertuccioli του/της Enrico Bertuccioli
on August 06, 2021
rating-star 3
Applause
favorite
Favorite
report spam
Spam

Are we all part of the same social experiment?

Πολιτικά »  National/Domestic  International  Elections  Finances  Economy & Money  Technology  Environment  Health  Family & Youth  Jobs & Social  Fraud & Corruption  Politicians  Parties  Privacy & Customer  Democracy

pandemiccornaviruscovid19virusviraleconomymoneybusinessspeculaitonspeculatorsexperimentsocialsocialmediapeoplesocietystrategypoliticalpolicypoliticiansinetrnationalglobalnationalcrisisdatabigdatadataprotectionfakenewsnewsfakesystemfinancefinancialproblemgovernmentpandemiccornaviruscovid19virusviraleconomymoneybusinessspeculaitonspeculatorsexperimentsocialsocialmediapeoplesocietystrategypoliticalpolicypoliticiansinetrnationalglobalnationalcrisisdatabigdatadataprotectionfakenewsnewsfakesystemfinancefinancialproblemgovernment

Σχόλια (0)

Σχολιάστε  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Περισσότερα από αυτόν τον χρήστη Enrico Bertuccioli


Cartoon: The US political show (small) by Enrico Bertuccioli tagged uspresidentialelections,donaldtrump,joebiden,gop,republicanparty,democraticparty,electionrace,government,presidentialrace,money,economy,business,lobbying,politicalcartoon,editorialcartoon,usvoters
The US political show
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Weapon business (small) by Enrico Bertuccioli tagged weapons,weapon,business,arms,armsbusiness,money,war,political,global,armstrade,weaponindustry,military,profit,production,technology
Weapon business
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.