toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Ypidemi Fake News (medium) by bob schroeder tagged fake,news,career,campaign,indignation,business,money,google,comics,ypidemi

Ypidemi Fake News

#325094 / viewed 3954 times
bob schroeder του/της bob schroeder
on November 14, 2018
rating-star 0
Applause
favorite
Favorite
report spam
Spam

my fake news career finally gets us out of here.

Ενημέρωση & Πολιτισμός »  Internet  Press  Society  Consumption  Traditions  Lifestyle  Horror & Sci-Fi

fakenewscareercampaignindignationbusinessmoneygooglecomicsypidemi

Portfolios

(1)
Ypìdemi [en]

Σχόλια (0)

Σχολιάστε  
 

Περισσότερα από αυτόν τον χρήστη bob schroeder


Cartoon: endlich zuckerfrei (small) by bob schroeder tagged zuckerfrei,diabetes,versteckterzucker,kopftuchmädchen,diy,schokobrunnen,historisch,comic
endlich zuckerfrei
Cartoon: top_Monica29 Selbsttest (small) by bob schroeder tagged corona,covid19,selbsttest,infektion,antigen,test,schnelltest,anwender,impfung,termin,user,ai,ki
top_Monica29 Selbsttest
Cartoon: fluchttunnel (small) by bob schroeder tagged ddr,berlin,mauer,grenze,tunnel,flucht,tag,deutsche,einheit
fluchttunnel
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.