toonpool logo
  • Agent
  • Collections
  • περισσότερα
    • Community
    • Χρήστες
    • Ειδική Αναζήτηση
    • Βοήθεια
  • Εγγραφή




    • Password lost?
  • Εγκατάσταση λογαριασμού
  • Ελληνικά
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Νεότερες γελοιογραφίες
Cartoon: Digital devices addiction (medium) by Enrico Bertuccioli tagged technology,digital,devices,data,internet,smartphone,social,media,mind,mental,people,disease,psychological,psychology,connection,health,policy,abuse,power,control,surveillance,mobile,youth,children,game,video,knowledge,awareness,family,psychiatric,information,safety,global,world,problem,security,electronic,virtuality,reality,virtual,prevention,education

Digital devices addiction

#377899 / viewed 3929 times
Enrico Bertuccioli του/της Enrico Bertuccioli
on February 18, 2021
rating-star 5
Applause
favorite
Favorite
report spam
Spam

Hyperconnected...

Ενημέρωση & Πολιτισμός »  Internet  Multimedia  TV & Broadcasting  PC & Video Games  Education  Society  Family & Youth  Consumption  Free time  Lifestyle  Film & Theater

technologydigitaldevicesdatainternetsmartphonesocialmediamindmentalpeoplediseasepsychologicalpsychologyconnectionhealthpolicyabusepowercontrolsurveillancemobileyouthchildrengamevideoknowledgeawarenessfamilypsychiatricinformationsafetyglobalworldproblemsecurityelectronicvirtualityrealityvirtualpreventioneducation

Σχόλια (2)

 
Enrico Bertuccioli
Member
many thanks Menekse.

Enrico Bertuccioli, on February 22, 2021  report post  απάντηση applause 0

 
menekse cam
Member
Strong!!*****

menekse cam, on February 21, 2021  report post  απάντηση applause 0

 
 

Σχολιάστε

Περισσότερα από αυτόν τον χρήστη Enrico Bertuccioli


Cartoon: Against the wall (small) by Enrico Bertuccioli tagged europe,europeancrisis,war,sovereignism,nationalism,authoritarianism,walls,dream,division,europeancommunity,peace,reforms,solidarity,europeanunion,extremism,populism,populistpropaganda,farright,extremeright,europeanelections,political,politicalcartoons,editorialcartoon
Against the wall
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Political trolls (small) by Enrico Bertuccioli tagged elections,politicalelections,propaganda,politicalpropaganda,fakenews,disinformation,politicaldisinformation,socialmedia,artificialintelligence,democracy,authoritarianism,populism,populist,populistpropaganda,voters,data,privacy,technology,political,politicalcartoon,politicalcartoons,editorialcartoons,editorialcartoon
Political trolls
  • Service

  • ToonAgent
  • βοήθεια
  • FAQ
  • Daily Toon
  • About Us

  • About Us
  • Contact
  • Terms of Use
  • Privacy Policy
  • Manage cookies
  • Community

  • Community
  • Ειδική Αναζήτηση
  • Collections
  • Εγκατάσταση λογαριασμού
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.